PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cotton_A_27562_BGI-A2_v1.0
Common NameF383_23163
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 556aa    MW: 60495.7 Da    PI: 4.8437
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cotton_A_27562_BGI-A2_v1.0genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.21.7e-174087148
                                TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
             Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                                +g+WT  Ed +l+d+vk++G g+W+++ ++ g+ R++k+c++rw ++l
  Cotton_A_27562_BGI-A2_v1.0 40 KGPWTSAEDAILIDYVKKHGEGNWNAVQKHSGLFRCGKSCRLRWANHL 87
                                79******************************************9986 PP

2Myb_DNA-binding53.94.1e-1793136146
                                 TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
             Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                                 +g++T+eE++l++++++++G++ W++ a++++ gRt++++k++w++
  Cotton_A_27562_BGI-A2_v1.0  93 KGAFTQEEEQLIIELHAKMGNK-WARMAAHLP-GRTDNEIKNYWNT 136
                                 799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.0373587IPR017930Myb domain
SuperFamilySSF466892.55E-3039134IPR009057Homeodomain-like
SMARTSM007172.4E-153989IPR001005SANT/Myb domain
PfamPF002492.4E-154087IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.2E-244194IPR009057Homeodomain-like
CDDcd001676.41E-124287No hitNo description
PROSITE profilePS5129426.87288142IPR017930Myb domain
SMARTSM007172.3E-1792140IPR001005SANT/Myb domain
PfamPF002494.4E-1693136IPR001005SANT/Myb domain
CDDcd001671.11E-1295136No hitNo description
Gene3DG3DSA:1.10.10.602.8E-2695141IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009789Biological Processpositive regulation of abscisic acid-activated signaling pathway
GO:0043068Biological Processpositive regulation of programmed cell death
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0045926Biological Processnegative regulation of growth
GO:0048235Biological Processpollen sperm cell differentiation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 556 aa     Download sequence    Send to blast
MSHTKHERED GMLSKDQTES PYIDDGSCGG GGAGGVVLKK GPWTSAEDAI LIDYVKKHGE  60
GNWNAVQKHS GLFRCGKSCR LRWANHLRPN LKKGAFTQEE EQLIIELHAK MGNKWARMAA  120
HLPGRTDNEI KNYWNTRIKR RQRAGLPLYP PEVCLQALQE SHSTSVVNGL DKGPNDILQN  180
NSYEIPDVIF DSLKANQNVL PYVPELPVLS ASSMLMKGLG SSQYCGFMQP TIHRQKRLRE  240
SPAFFPGYTG AVKNECPLFM QFQDDISDKA AGSFGLSFPI EPDPATKNSQ PFGVFPGSHA  300
LSNGNFSASE PPLEAVKLEL PSLQYPETEL GNWGTLTCPP PLLESVDAFI QSPPPTSGLE  360
SDSLSPRNSG LLDALLHEAK TLSSAKNHAS DKSSNSSTPG DIAEGSNFNI CETEWEKCGE  420
PLSPMGNSAT SLFSECISAS GSSLDEQPPA ETVTESHLKS EPADCVLTPE IQKEAPIRLD  480
SSRPDTLLAS NWLEQGSGYD KDQAILTNAI SSLLGDDLRN EYKNMAEGTS ISSQAWGLDS  540
CAWNNMPAVC QMSELP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-32381415107B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00490DAPTransfer from AT5G06100Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ4591461e-68AJ459146.1 Gossypium hirsutum partial myb118 gene, clone pGhMYB118.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012447383.10.0PREDICTED: transcription factor GAMYB-like
RefseqXP_012447382.10.0PREDICTED: transcription factor GAMYB-like
RefseqXP_012447381.10.0PREDICTED: transcription factor GAMYB-like
RefseqXP_012447380.10.0PREDICTED: transcription factor GAMYB-like
TrEMBLA0A0B0MGJ50.0A0A0B0MGJ5_G
STRINGVIT_13s0067g01630.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM38022859
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06100.31e-145myb domain protein 33